Oven BakedPizzaChickenFrench Breadhoney

BBQ Chicken French Bread Pizza

Nutriforks
Nutriforks
·5 min read·Published: Feb 13, 2026
BBQ Chicken French Bread Pizza
Jump to RecipeSave Recipe

This BBQ Chicken French Bread Pizza uses store-bought French bread and rotisserie chicken for a quick, family-friendly meal. Loaded with BBQ sauce, bacon, pineapple, and

More ways to enjoy easy: Creamy Chicken Noodle Soup, French Bread Pizza, Caprese Pizza, or Lemon Arugula Pizza.

Why This BBQ Chicken French Bread Pizza Is a Family Favorite

This BBQ Chicken French Bread Pizza is the kind of dinner that makes everyone happy. Josh asks for it all the time, and the boys clean their plates without a word. The secret? Store-bought French bread and a rotisserie chicken keep it fast, while the sweet BBQ sauce, smoky bacon, and spicy jalapeño make it feel like a treat. It’s our go-to for Father’s Day or any night we need a quick win.

Why You’ll Love This BBQ Chicken French Bread Pizza

  • No dough needed, store-bought French bread becomes a crispy crust in just 15 minutes.
  • Loaded with flavor, tangy BBQ sauce, tender chicken, salty bacon, and a pop of pineapple.
  • Customizable, add or skip toppings to suit your family’s tastes.

Key Ingredients for BBQ Chicken French Bread Pizza

  • French bread: Look for a loaf that’s crusty on the outside and soft inside. Day-old bread works fine and gets even crispier. Substitute with a baguette or ciabatta.
  • Rotisserie chicken: Saves time and adds flavor. Shred it while still warm for easier handling. You can also use leftover grilled or baked chicken.
  • Honey sweet BBQ sauce: The sweetness balances the spicy jalapeño and salty bacon. Use your favorite brand or homemade. If you prefer a tangier sauce, go with a Kansas City style.

Kitchen Tools for BBQ Chicken French Bread Pizza

  • Large baking sheet (rimmed to catch any drips)
  • Sharp knife for slicing the bread
  • Medium bowl for mixing chicken and sauce

Tips for the Best French Bread Pizza

The key to a crisp crust is not overloading the bread with sauce or wet toppings. Spread the BBQ sauce evenly but thinly, and pat the pineapple pieces dry with a paper towel before adding them. This keeps the bread from getting soggy.

For the best texture, use a rotisserie chicken that’s already shredded. It saves time and the meat stays juicy. If you’re using leftover cooked chicken, make sure it’s not dry, toss it with a little extra BBQ sauce to keep it moist.

BBQ Chicken French Bread Pizza Variations to Try

You can easily change up the toppings. Swap the chicken for pulled pork or shredded beef for a different protein. If you want a vegetarian version, use black beans and corn instead of chicken and bacon. For a spicier kick, add more jalapeño or drizzle with hot honey before serving. And if you’re not a fan of pineapple, try diced mango or just leave it out.

What to Serve with BBQ Chicken French Bread Pizza

Serve this pizza with a simple green salad dressed with ranch or a tangy vinaigrette to balance the sweetness. A side of coleslaw or corn on the cob would also work well. For dipping, extra BBQ sauce or ranch dressing on the side is always a hit.

How to Store Leftover BBQ Chicken French Bread Pizza

Leftover pizza keeps well in the fridge for up to 3 days. Wrap each piece tightly in foil or store in an airtight container. The bread will soften a bit, but it’s still tasty.

Can You Freeze BBQ Chicken French Bread Pizza?

You can freeze baked pizza slices for up to 2 months. Let them cool completely, then wrap individually in plastic wrap and foil. To serve, reheat from frozen in a 375°F oven for about 10 minutes until hot and crisp.

Best Way to Reheat BBQ Chicken French Bread Pizza

The best way to reheat this pizza is in the oven or a toaster oven at 350°F for 5-7 minutes. This restores the crispness of the bread. The microwave will make the crust soft, so avoid it if you can.

BBQ Chicken French Bread Pizza FAQs

Can I use a different type of bread?

Yes, any crusty bread works. A baguette or ciabatta will give a similar texture. Just slice it in half lengthwise and adjust baking time if the loaf is thinner.

Can I make this dairy-free?

Absolutely. Use a dairy-free shredded mozzarella or a vegan cheese blend. The rest of the toppings are naturally dairy-free.

How do I get the bread extra crispy?

Preheat your baking sheet in the oven for a few minutes before placing the bread on it. The hot surface helps the bottom crisp up faster.

Can I add more vegetables?

Sure. Diced bell peppers, sliced mushrooms, or even corn would be great additions. Just don’t overload the bread or it may get soggy.

Is this recipe spicy?

It’s mild as written because we use tamed jalapeño slices. For more heat, use fresh jalapeño or add a drizzle of hot sauce before serving.

Recipe

BBQ Chicken French Bread Pizza

BBQ Chicken French Bread Pizza

BBQ Chicken French Bread Pizza made with store-bought French bread and topped with BBQ sauce, chicken, bacon, mozzarella cheese, pineapple, jalapeño, and cilantro. This easy pizza is a favorite weeknight meal.

easyNut-Free

10 min

Prep Time

15 min

Cook Time

25 min

Total Time

4

Servings

Dinner

Course

American

Cuisine

1107 kcal

Calories

Ingredients

Servings
  • 1 loaf french bread
  • 2 cup shredded rotisserie chicken, shredded
  • 1 cup kroger honey sweet bbq sauce
  • 2 cup shredded mozzarella cheese, shredded
  • 6 slices cooked bacon, chopped
  • 0.5 cup canned pineapple pieces, drained
  • 0.25 cup sliced red onion, sliced
  • 0.25 cup tamed jalapeño slices, slices
  • 2 tbsp cilantro, chopped

Instructions

  1. 1

    Preheat the oven to 375 degrees F.

  2. 2

    Slice French bread loaf in half lengthwise and place on a large baking sheet.

  3. 3

    In a medium bowl, combine the shredded chicken with ½ cup of the BBQ sauce. Stir until chicken is coated.

  1. 4

    Spread the remaining ½ cup of BBQ sauce evenly on the bread. Top evenly with shredded cheese, chicken, bacon, pineapple, red onion, jalapeño slices, and chopped cilantro.

  2. 5

    Place the French bread pizza in the oven and bake for 15 minutes or until the cheese is melted and the bread is crisp around the edges. Remove from the oven and cut the pizza into pieces. Serve immediately.

Nutrition (per serving)

1107kcal

Calorie breakdown

Protein20%221 kcal
Fat67%753 kcal
Carbohydrates13%145 kcal
How this was calculated — 8 of 9 ingredients matched
shredded rotisserie chickenChicken, broiler, rotisserie, BBQ, skin1814 kcal
kroger honey sweet bbq sauceSauce, barbecue413 kcal
shredded mozzarella cheeseCheese, mozzarella, whole milk1435 kcal
cooked baconBacon, meatless556 kcal
canned pineapple piecesPineapple, raw, all varieties60 kcal
sliced red onionOnions, red, raw26 kcal
tamed jalapeño slicesPork, cured, ham, center slice, country-style, separable lean only, raw117 kcal
cilantroCoriander (cilantro) leaves, raw7 kcal
Serving size ≈ 413 g · 4 servings

Nutrition information is automatically calculated from USDA FoodData Central, so should only be used as an approximation. Actual values may vary depending on the ingredients, brands, and preparation methods used.

Open in analyzer

Keyword: bbq, Chicken, easy, family-friendly, kid-friendly, nutFree, Oven Baked, pizza, quick

This post may contain affiliate links. Read our disclosure policy.

Tags:bbqchickeneasyfamily-friendlykid-friendlypizzaquick

Share this recipe

You Might Also Like

View All →
Nutriforks

About the Author

Nutriforks

NutriForks is a home-cooking site built around two simple ideas: recipes should actually work, and you should know what’s in them. Every recipe pairs clear, tested instructions with a full nutrition breakdown, so healthy, everyday cooking is genuinely easy.

Leave a comment

Your email address will not be published. Required fields are marked *

Recipe Rating