SkilletSaladBasil Vinaigrettewhite asparaguszucchini

Zucchini Noodles with Asparagus, Peas, and Basil Vinaigrette

Nutriforks
Nutriforks
·5 min read
Zucchini Noodles with Asparagus, Peas, and Basil Vinaigrette
Jump to RecipeSave Recipe

This zucchini noodles with asparagus, peas, and basil vinaigrette recipe is a light, 15-minute spring meal that’s vegan and gluten-free. Perfect for a healthy weeknight d

These pair naturally with what you’re making now: Grilled Ratatouille Pasta Salad, Summer Squash Sauté, or Summer Arugula Salad with Basil Vinaigrette.

Why This Zucchini Noodle Recipe Is My Go-To Spring Reset

Earlier this week I was in Austin, and I ate my weight in tacos, chips, salsa, and guacamole. It was amazing, but when I got home, I craved something fresh and green. This zucchini noodles with asparagus, peas, and basil vinaigrette was exactly what I needed. It’s light, quick to make, and my kids actually love the spiralized zucchini, they think it’s funny to eat noodles made from vegetables. We use our Inspiralizer, but a good julienne peeler works if you don’t have one.

Why You’ll Love These Spring Zucchini Noodles

  • This dish comes together in under 15 minutes, making it a perfect weeknight meal when you want something healthy fast.
  • The basil vinaigrette brings a bright, herbaceous flavor that doesn’t weigh down the vegetables.
  • It’s naturally vegan and gluten-free, so it works for a variety of diets without extra effort.

Key Ingredients for This Light Spring Meal

  • Zucchini: Choose small to medium zucchini, as they are less watery and have smaller seeds. Avoid very large ones, which can be bitter and mushy.
  • Asparagus: Look for bright green spears with tight tips. Snap off the woody ends where they naturally break to avoid tough bits.
  • Basil Vinaigrette: You can use a good-quality store-bought vinaigrette, or make your own by blending fresh basil, olive oil, lemon juice, garlic, salt, and pepper. This will give you the freshest flavor.

Kitchen Tools for Easy Zucchini Noodles

  • Spiralizer (or julienne peeler): Essential for turning zucchini into noodles. A box grater with a julienne attachment also works.
  • Large skillet: For sautéing the vegetables. A 12-inch skillet gives enough room to toss.
  • Tongs: For mixing the noodles with the vinaigrette without breaking them.

Tips for Making Zucchini Noodles with Asparagus Peas and Basil Vinaigrette

The key to great zucchini noodles is not overcooking them. They only need about 1 minute in the pan, just enough to warm through. If you cook them longer, they release water and turn mushy. Before spiralizing, pat the zucchini dry with paper towels to remove surface moisture; this helps them stay firm. For the asparagus, snap off the tough ends where they naturally break, then cut the spears into 2-inch pieces. If your asparagus is thick, you may need an extra minute of cooking.

Spring Zucchini Noodles Variations to Try

You can swap the asparagus for green beans or broccoli florets, adjust cooking time as needed. Cherry tomatoes, halved and tossed in at the end, add a pop of color and sweetness. For a different flavor profile, try a lemon-herb vinaigrette instead of basil, or add a pinch of red pepper flakes for heat. To make it heartier, stir in a cup of cooked quinoa or farro before serving.

What to Serve with Your Light Spring Meal

This dish is light enough to serve as a side, but I usually make it a main by adding grilled chicken, shrimp, or some chickpeas for protein. A slice of crusty bread on the side is nice for soaking up any extra vinaigrette. If you want a little crunch, sprinkle toasted pine nuts or slivered almonds on top.

How to Store Leftover Zucchini Noodles

These zucchini noodles are best eaten immediately after cooking. If you have leftovers, store them in an airtight container in the refrigerator for up to one day. The noodles will soften and release water, so they won’t have the same texture. They can be eaten cold, like a pasta salad, but I don’t recommend reheating because they’ll become mushy. Freezing is not recommended.

Zucchini Noodles with Asparagus Peas and Basil Vinaigrette FAQs

Can I use a vegetable peeler instead of a spiralizer?

Yes, a vegetable peeler will make wide ribbon noodles. They cook up similarly, just keep an eye on them as they may be thinner and cook even faster.

Is this recipe vegan and gluten-free?

Yes, as long as the basil vinaigrette you use is vegan and gluten-free. Most store-bought vinaigrettes are, but check the label to be sure. The vegetables themselves are naturally plant-based and gluten-free.

Can I use fresh peas instead of frozen?

Absolutely. If using fresh peas, blanch them in boiling water for 1-2 minutes until tender, then drain and add them to the skillet at the same point you would add frozen peas.

How do I keep the zucchini noodles from getting soggy?

Pat the spiralized zucchini dry with paper towels before cooking. Also, only cook them for about a minute, just enough to warm them. Overcooking is the main cause of sogginess.

Recipe

Zucchini Noodles with Asparagus, Peas, and Basil Vinaigrette

Zucchini Noodles with Asparagus, Peas, and Basil Vinaigrette

Zucchini Noodles with Asparagus, Peas, and Basil Vinaigrette is the perfect spring meal. It is light, refreshing, and super simple to make.

easyVegan

15 min

Prep Time

10 min

Cook Time

25 min

Total Time

4

Servings

Lunch

Course

American

Cuisine

82 kcal

Calories

Ingredients

Servings
  • 3 small zucchini
  • 1 tbsp olive oil
  • 1 bunch asparagus, cut into 1-inch pieces, woody ends discarded
  • 0.75 cup frozen peas
  • 0.5 cup basil vinaigrette
  • to taste salt and pepper

Instructions

  1. 1

    Spiralize the zucchini, according to manufacturer's instructions, and set aside.

  1. 2

    In a large skillet, heat the olive oil over medium-high heat. Add the asparagus and cook until tender, about 5 minutes. Stir in the peas and cook for 2 minutes. Add the zucchini noodles and cook for 1 minute, just so the noodles are warmed. You don't want to really cook them or they will get soggy. Remove from heat and pour the basil vinaigrette over the zucchini noodles. Toss with tongs until the noodles and vegetables are evenly coated. Season with salt and freshly ground black pepper, to taste. Serve immediately.

Nutrition (per serving)

82kcal

Calorie breakdown

Protein18%16 kcal
Fat44%38 kcal
Carbohydrates38%33 kcal
How this was calculated — 6 of 6 ingredients matched
small zucchiniSquash, zucchini, baby, raw1 kcal
olive oilOil, corn, peanut, and olive133 kcal
asparagusAsparagus, raw20 kcal
frozen peasPeas, green, raw146 kcal
basil vinaigretteBasil, fresh28 kcal
salt and pepperPeppers, sweet, red, cooked, boiled, drained, with salt0 kcal
Serving size ≈ 105 g · 4 servings

Nutrition information is automatically calculated from USDA FoodData Central, so should only be used as an approximation. Actual values may vary depending on the ingredients, brands, and preparation methods used.

Open in analyzer

Keyword: dairyFree, gluten-free, glutenFree, kid-friendly, Skillet, spring, vegan, vegetarian

This post may contain affiliate links. Read our disclosure policy.

Tags:gluten-freekid-friendlyspringveganvegetarian

Share this recipe

You Might Also Like

View All →
Nutriforks

About the Author

Nutriforks

NutriForks is a home-cooking site built around two simple ideas: recipes should actually work, and you should know what’s in them. Every recipe pairs clear, tested instructions with a full nutrition breakdown, so healthy, everyday cooking is genuinely easy.

Leave a comment

Your email address will not be published. Required fields are marked *

Recipe Rating