No-CookAlmondsblueberriesoats

Overnight Blueberry Almond Oats

Nutriforks
Nutriforks
·5 min read·Published: Feb 2, 2026
Overnight Blueberry Almond Oats
Jump to RecipeSave Recipe

Prepare these overnight blueberry almond oats the night before for a creamy, no-cook breakfast. Wake up to a healthy, delicious meal that’s ready when you are!

Another reason to love vegetarian: Strawberry Watermelon Cucumber Salad, Green Salad, Brown Butter Maple Granola, or Maple Roasted Blueberry Almond Oatmeal.

A No-Cook Breakfast That Actually Tastes Great

I started making these overnight blueberry almond oats during a July heatwave, when the last thing I wanted was a hot stove. July is National Blueberry Month, and I had a pint of blueberries sitting on the counter. I stirred together old-fashioned oats, almond milk, plain Greek yogurt, a dash of cinnamon, and a handful of blueberries in a jar, covered it, and put it in the fridge before bed. In the morning, I took it out, topped it with sliced almonds, extra blueberries, and another sprinkle of cinnamon, and ate it cold. The oats had softened into a creamy, almost pudding-like texture, and the blueberries had stained the yogurt a pretty purple. The almonds added a nice crunch. I know cold oats sound odd, but they’re surprisingly tasty, especially in summer.

Why You’ll Love This Healthy Breakfast Recipe

  • No cooking required. You mix everything in a jar the night before, and breakfast is ready when you wake up. No stove, no microwave, no fuss.
  • Thick and satisfying. The Greek yogurt gives the oats a rich, thick texture, while the blueberries add natural sweetness and a pop of color.
  • Only one dish to wash. Mix and store in the same jar, just rinse it out in the morning.

Key Ingredients for Overnight Blueberry Almond Oats

  • Old-fashioned rolled oats, These are the backbone of the recipe. They soften overnight without turning mushy. Don’t substitute quick oats or steel-cut; quick oats get gluey, and steel-cut stay too chewy. Look for certified gluten-free oats if needed.
  • Plain Greek yogurt, Adds creaminess and a protein boost. Full-fat or 2% gives the richest texture, but nonfat works too. If you use vanilla yogurt, you can skip any added sweetener. For a dairy-free option, use a thick plant-based yogurt.
  • Fresh blueberries, They burst as they sit, releasing juice that flavors the oats. Frozen blueberries work as a substitute; add them straight from the freezer. In season, local blueberries are sweeter and more flavorful.

Kitchen Tools for Easy Overnight Oats

  • A jar or container with a tight-fitting lid, A 16-ounce mason jar works perfectly. The lid keeps the oats from absorbing fridge odors and makes for easy transport.
  • A spoon or small whisk, For stirring the ingredients together. A fork works in a pinch.

Tips for Making the Best Overnight Blueberry Almond Oats

Use old-fashioned rolled oats, not quick oats or steel-cut. Old-fashioned oats soften just enough overnight to stay creamy but not mushy. Quick oats can turn to paste, and steel-cut oats won’t soften enough without cooking. If you like your oats sweeter, stir in a teaspoon of brown sugar or a drizzle of honey before refrigerating. The recipe as written is lightly sweet from the blueberries, but a little extra sweetness never hurts. Also, make sure your jar or bowl has a tight lid so the oats don’t absorb fridge smells.

Overnight Oats Variations to Try

Swap the blueberries for raspberries, strawberries, or chopped peaches, any soft fruit works. Use coconut milk or regular dairy milk instead of almond milk. For a dairy-free version, replace the Greek yogurt with a plant-based yogurt (plain or vanilla). Add a tablespoon of chia seeds or ground flaxseed for extra fiber and omega-3s; they’ll also thicken the oats further. If you want a sweeter base, use vanilla-flavored yogurt and skip the added sweetener.

Serving Suggestions for Blueberry Almond Breakfast

I eat these oats straight from the jar, but you can spoon them into a bowl if you prefer. Top with the sliced almonds, extra fresh blueberries, and a dusting of cinnamon as the recipe calls for. For extra crunch, add a tablespoon of toasted coconut or chopped pecans. If you want a heartier breakfast, serve alongside a hard-boiled egg or a slice of whole-grain toast with nut butter. The oats are filling on their own, though, the Greek yogurt adds protein that keeps you full until lunch.

How to Store Leftover Overnight Oats

These oats are best eaten the morning after they’re made, but you can store any leftovers in the refrigerator in a sealed container for a couple of days. The texture will continue to soften, and the blueberries may release more juice, but they’ll still be good. Give them a stir before eating. If the oats seem too thick, stir in a splash of milk to loosen them up.

Overnight Blueberry Almond Oats FAQs

Can I use frozen blueberries instead of fresh?

Yes, frozen blueberries work well. No need to thaw them first; just add them straight to the jar. They’ll thaw overnight and release some juice, which makes the oats even more flavorful.

Can I make these oats vegan?

Yes, use a plant-based yogurt (like coconut or soy yogurt) and a non-dairy milk. The recipe already uses almond milk, so just swap the yogurt. The texture will be slightly different but still creamy.

How long do the oats need to sit?

At least 6-8 hours, or overnight. The oats need time to absorb the liquid and soften. If you’re in a hurry, you can let them sit for 4 hours, but they won’t be as creamy.

Can I eat these oats warm?

Yes, if you prefer warm oats, you can microwave the jar for 30-60 seconds after refrigerating. The texture will still be creamy, but the blueberries will be warm. The recipe is designed to be eaten cold, though.

Recipe

Overnight Blueberry Almond Oats

Overnight Blueberry Almond Oats

Make this easy oatmeal the night before and wake up to a delicious and healthy breakfast!

easyVegetarian

10 min

Prep Time

10 min

Total Time

1

Servings

Breakfast

Course

1201 kcal

Calories

Ingredients

Servings
  • 0.333 cup old fashioned oats
  • 0.333 cup almond milk
  • 0.333 cup plain Greek yogurt
  • 0.25 cup fresh blueberries
  • dash cinnamon
  • 2 tbsp sliced almonds
  • extra blueberries, for serving
  • extra cinnamon, for serving

Instructions

  1. 1

    Stir oats, milk, yogurt, blueberries, and cinnamon together in a jar or bowl. Cover and place in refrigerator overnight. In the morning, remove from refrigerator and top with almonds, extra blueberries, and cinnamon. Enjoy! Note-if you want to sweeten up your oats, feel free to add a bit of brown sugar or honey!

    Nutrition (per serving)

    1201kcal

    Calorie breakdown

    Protein9%123 kcal
    Fat49%661 kcal
    Carbohydrates42%569 kcal
    How this was calculated — 7 of 8 ingredients matched
    old fashioned oatsOat bran, raw197 kcal
    almond milkCandies, milk chocolate, with almonds420 kcal
    plain Greek yogurtYogurt, Greek, plain, whole milk78 kcal
    fresh blueberriesToaster pastries, fruit (includes apple, blueberry, cherry, strawberry)233 kcal
    sliced almondsOil, almond265 kcal
    extra blueberriesToaster pastries, fruit (includes apple, blueberry, cherry, strawberry)4 kcal
    extra cinnamonCinnamon buns, frosted (includes honey buns)5 kcal
    Serving size ≈ 332 g · 1 serving

    Nutrition information is automatically calculated from USDA FoodData Central, so should only be used as an approximation. Actual values may vary depending on the ingredients, brands, and preparation methods used.

    Open in analyzer

    Keyword: breakfast, healthy, No-Cook, vegetarian

    This post may contain affiliate links. Read our disclosure policy.

    Tags:breakfasthealthymake-aheadvegetarian

    Share this recipe

    You Might Also Like

    View All →
    Nutriforks

    About the Author

    Nutriforks

    NutriForks is a home-cooking site built around two simple ideas: recipes should actually work, and you should know what’s in them. Every recipe pairs clear, tested instructions with a full nutrition breakdown, so healthy, everyday cooking is genuinely easy.

    Leave a comment

    Your email address will not be published. Required fields are marked *

    Recipe Rating