SkilletSandwichAvocadoCheddar Cheesecilantro

Guacamole Grilled Cheese Sandwich

Nutriforks
Nutriforks
·6 min read·Published: May 19, 2026
Guacamole Grilled Cheese Sandwich
Jump to RecipeSave Recipe

This guacamole grilled cheese sandwich combines creamy avocado, melted cheddar, and crispy bread for an easy 15-minute lunch. Try it tonight!

Since easy is on the menu, Egg, Avocado, and Pesto Bagel Sandwich, Roasted Broccoli Grilled Cheese, Green Goddess Salad, and Sweet Potato and Kale Grilled Cheese fit right alongside it.

Why This Guacamole Grilled Cheese Sandwich Works So Well

I stumbled onto this guacamole grilled cheese sandwich one afternoon when I had half a batch of guacamole left over from taco night. I figured, why not slap it between two slices of bread with some cheddar? The result was so good that I now make the guacamole specifically for this sandwich. The creamy avocado and melted cheese on crispy bread is a combination that just works.

3 Reasons to Love This Avocado Grilled Cheese

  • It comes together in under 15 minutes, making it a perfect quick lunch.
  • The creamy avocado from the homemade guacamole pairs beautifully with sharp cheddar cheese.
  • You can customize it with whatever you have on hand, from bacon to different cheeses.

Key Ingredients for a Great Guacamole Grilled Cheese

  • Avocados, Use Hass avocados for their creamy texture. They should be ripe but not mushy. If they’re too firm, the guacamole won’t mash well. Substitution: you can use frozen avocado chunks, but fresh is best.
  • Cheddar Cheese, Sharp cheddar gives a stronger flavor that stands up to the guacamole. Pre-shredded cheese works but melts less smoothly; shred your own for best results.
  • Crusty White Bread, A sturdy bread like sourdough or a thick country loaf holds up better than soft sandwich bread. It gives a satisfying crunch.

Kitchen Tools for This Grilled Cheese Sandwich

  • Skillet or griddle for even heating
  • Spatula for flipping
  • Mixing bowl and fork for mashing guacamole
  • Chef’s knife and cutting board

Tips for Making the Best Guacamole Grilled Cheese

When making the guacamole, use ripe avocados that yield to gentle pressure. Overmashing can make it pasty, so leave some chunks for texture. Butter the outer sides of the bread generously and grill over medium-high heat. Two minutes per side should give you a golden, crispy crust. If the cheese isn’t fully melted by the time the bread is brown, lower the heat slightly and cover the pan with a lid for the last minute.

Expert Tips for a Perfectly Crispy Grilled Cheese

To get that diner-style even browning, press the sandwich gently with a spatula while it cooks. This ensures the bread makes full contact with the pan. If you’re using a thick bread, consider toasting it lightly before assembling to help it hold up to the moist guacamole. Also, let the sandwich rest for 30 seconds after grilling before cutting, this lets the cheese set slightly and prevents the filling from oozing out.

How to Keep the Bread Crisp in Your Guacamole Grilled Cheese

The biggest challenge with a guacamole grilled cheese is keeping the bread from getting soggy. The moisture in the avocado can soften the bread before it has a chance to crisp. Here’s how to avoid that: spread the guacamole in a thin, even layer, don’t pile it on. Use a crusty bread like sourdough or a rustic white loaf, which has a denser crumb. Grill the sandwich over medium-high heat so the bread browns quickly before the moisture soaks in. And don’t let the finished sandwich sit; serve it right away for maximum crunch.

Guacamole Grilled Cheese Variations to Try

If you want to add protein, layer in some crispy bacon or sliced grilled chicken. For a spicier version, use pepper jack cheese instead of cheddar and add an extra jalapeño to the guacamole. You can also swap the white bread for whole wheat or sourdough for a different texture. To make it dairy-free, use a vegan cheese that melts well and skip the butter, brush the bread with olive oil instead.

What to Serve with Guacamole Grilled Cheese

This sandwich is hearty enough to stand on its own, but it pairs beautifully with a bowl of tomato soup or a simple side salad. For a little extra kick, serve it with a side of salsa or sour cream for dipping. I also like to add a handful of tortilla chips on the plate for crunch.

How to Store Leftover Guacamole

The sandwich is best eaten fresh, but if you have leftover guacamole, store it in an airtight container. Press a piece of plastic wrap directly onto the surface of the guacamole to prevent browning, then refrigerate. It will keep for about a day. Stir it before using again.

Guacamole Grilled Cheese FAQs

Can I use store-bought guacamole?

Yes, you can use store-bought guacamole in a pinch. But homemade gives you better control over texture and flavor, and it’s easy to make with just a few ingredients.

What cheese works best for this sandwich?

Sharp cheddar is classic, but Monterey Jack, pepper jack, or a mix of cheeses all work well. Choose a cheese that melts smoothly for the best texture.

How do I keep the avocado from turning brown?

Fresh lime juice in the guacamole helps slow browning. For leftovers, press plastic wrap directly onto the surface before refrigerating to limit air exposure.

Can I make this vegan?

Absolutely. Use a vegan cheese that melts well and brush the bread with olive oil instead of butter. The guacamole is already plant-based.

What if I don’t have a jalapeño?

Skip it or add a pinch of cayenne pepper for heat. You can also use a few dashes of hot sauce mixed into the guacamole.

Recipe

Guacamole Grilled Cheese Sandwich

Guacamole Grilled Cheese Sandwich

The guacamole takes this grilled cheese sandwich to a whole new level of goodness.

easyVegetarian

5 min

Prep Time

4 min

Cook Time

9 min

Total Time

2

Servings

Lunch

Course

American

Cuisine

416 kcal

Calories

Ingredients

Servings

guacamole

  • 2 ripe avocados
  • 0.5 small onion, minced
  • 1 clove garlic, minced
  • 1 jalapeño, stems and seeds removed, minced
  • 2 tbsp cilantro leaves, finely chopped
  • 1 tbsp fresh lime juice
  • 0.5 tsp coarse salt
  • freshly grated black pepper
  • 1 Roma tomato, chopped

grilled cheese

  • 4 slices crusty white bread
  • 4 slices Cheddar cheese
  • butter, for buttering bread

Instructions

  1. 1

    To make the guacamole-cut avocados in half. Remove seed. Scoop out avacado from the peel, put in a large bowl. Using a fork, mash the avocado. Add the onion, garlic, jalapeño, cilantro, lime juice, salt and pepper. Stir until well combined. Add the chopped tomato and stir.

  1. 2

    Heat a pan or griddle to medium-high heat. Spread desired amount of guacamole on both slices of bread then top with cheese. Butter outer slices of bread and grill on one side for about 2 minutes or until golden and crispy. Flip the sandwich and grill until golden brown. Make the other sandwich the same way and serve warm.

Nutrition (per serving)

416kcal

Calorie breakdown

Protein19%82 kcal
Fat46%197 kcal
Carbohydrates35%149 kcal
How this was calculated — 12 of 12 ingredients matched
ripe avocadosBananas, ripe and slightly ripe, raw2 kcal
small onionOnions, raw0 kcal
garlicGarlic, raw7 kcal
jalapeñoPeppers, jalapeno, raw0 kcal
cilantro leavesCoriander (cilantro) leaves, raw7 kcal
fresh lime juiceLime juice, raw4 kcal
coarse saltSalt, table0 kcal
freshly grated black pepperPepper, banana, raw0 kcal
Roma tomatoTomatoes, red, ripe, canned, packed in tomato juice0 kcal
crusty white breadBread, pita, whole-wheat314 kcal
Cheddar cheeseCheese, cheddar490 kcal
butterButter, salted7 kcal
Serving size ≈ 150 g · 2 servings

Nutrition information is automatically calculated from USDA FoodData Central, so should only be used as an approximation. Actual values may vary depending on the ingredients, brands, and preparation methods used.

Open in analyzer

Keyword: easy, kid-friendly, nutFree, sandwich, Skillet, vegetarian

This post may contain affiliate links. Read our disclosure policy.

Tags:easykid-friendlysandwichvegetarian

Share this recipe

You Might Also Like

View All →
Nutriforks

About the Author

Nutriforks

NutriForks is a home-cooking site built around two simple ideas: recipes should actually work, and you should know what’s in them. Every recipe pairs clear, tested instructions with a full nutrition breakdown, so healthy, everyday cooking is genuinely easy.

Leave a comment

Your email address will not be published. Required fields are marked *

Recipe Rating